Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries) |
Domain d2jccl1: 2jcc L:0-117 [147973] Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb2, d2jccb3, d2jcce2, d2jccf2, d2jcch1, d2jcch2, d2jcci2, d2jcci3, d2jccl2, d2jccm2 automatically matched to d1lp9e1 mutant |
PDB Entry: 2jcc (more details), 2.5 Å
SCOPe Domain Sequences for d2jccl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jccl1 b.1.1.1 (L:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn
Timeline for d2jccl1: