Lineage for d2jcch1 (2jcc H:182-275)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784409Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300
    Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor
    Uniprot P30481 25-300
    Uniprot P01892 25-298
    Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 784574Domain d2jcch1: 2jcc H:182-275 [147970]
    Other proteins in same PDB: d2jcca2, d2jccb1, d2jcce1, d2jcce2, d2jccf1, d2jccf2, d2jcch2, d2jcci1, d2jccl1, d2jccl2, d2jccm1, d2jccm2
    automatically matched to d1akja1
    mutant

Details for d2jcch1

PDB Entry: 2jcc (more details), 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a
PDB Compounds: (H:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d2jcch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jcch1 b.1.1.2 (H:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d2jcch1:

Click to download the PDB-style file with coordinates for d2jcch1.
(The format of our PDB-style files is described here.)

Timeline for d2jcch1: