Lineage for d2jccf1 (2jcc F:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105586Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 1105604Domain d2jccf1: 2jcc F:1-117 [147968]
    Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb_, d2jcce2, d2jccf2, d2jcch1, d2jcch2, d2jcci_, d2jccl2, d2jccm2
    automatically matched to d1lp9f1
    mutant

Details for d2jccf1

PDB Entry: 2jcc (more details), 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a
PDB Compounds: (F:) tcr beta

SCOPe Domain Sequences for d2jccf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jccf1 b.1.1.1 (F:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi
pdgykasrpsqenfslilelaslsqtavyfcassdwvsyeqyfgpgtrltvle

SCOPe Domain Coordinates for d2jccf1:

Click to download the PDB-style file with coordinates for d2jccf1.
(The format of our PDB-style files is described here.)

Timeline for d2jccf1: