Lineage for d2j8wa1 (2j8w A:1-128)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765403Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
    Heme-containing proteins
  5. 765415Family a.24.3.2: Cytochrome c'-like [47179] (2 proteins)
  6. 765416Protein Cytochrome c' [47180] (8 species)
  7. 765438Species Rhodocyclus gelatinosus [TaxId:28068] [47185] (3 PDB entries)
  8. 765439Domain d2j8wa1: 2j8w A:1-128 [147931]
    automatically matched to d1jafa_
    complexed with hem

Details for d2j8wa1

PDB Entry: 2j8w (more details), 1.29 Å

PDB Description: the crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.3 a resolution and ph 8.0
PDB Compounds: (A:) cytochrome c'

SCOP Domain Sequences for d2j8wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8wa1 a.24.3.2 (A:1-128) Cytochrome c' {Rhodocyclus gelatinosus [TaxId: 28068]}
qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg
pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack
gchdkfke

SCOP Domain Coordinates for d2j8wa1:

Click to download the PDB-style file with coordinates for d2j8wa1.
(The format of our PDB-style files is described here.)

Timeline for d2j8wa1: