Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d2j8ui2: 2j8u I:1-99 [147926] Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub3, d2j8ue1, d2j8ue2, d2j8uf1, d2j8uf2, d2j8uh1, d2j8uh2, d2j8ui3, d2j8ul1, d2j8ul2, d2j8um1, d2j8um2 automated match to d1a9bb_ mutant |
PDB Entry: 2j8u (more details), 2.88 Å
SCOPe Domain Sequences for d2j8ui2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ui2 b.1.1.2 (I:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2j8ui2: