SCOPe 2.05: Domain d2j8uf2: 2j8u F:118-245

Lineage for d2j8uf2 (2j8u F:118-245)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d2j8uf2: 2j8u F:118-245 [147923]
   Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub_, d2j8ue1, d2j8uf1, d2j8uh1, d2j8uh2, d2j8ui_, d2j8ul1, d2j8um1
   automatically matched to d1lp9f2
   mutant

Details for d2j8uf2

PDB Entry: 2j8u, 2.88 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation.

PDB Compounds: (F:) ahiii tcr beta chain

SCOPe Domain Sequences for d2j8uf2:

Sequence; same for both SEQRES and ATOM records:

>d2j8uf2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

Timeline for d2j8uf2:

• d2j8uf2 first appeared in SCOP 1.75
  
• d2j8uf2 appears in SCOPe 2.04
  
• d2j8uf2 appears in SCOPe 2.06
  
• d2j8uf2 appears in the current release, SCOPe 2.08