SCOP 1.75: Domain d2j8ue2: 2j8u E:118-198

Lineage for d2j8ue2 (2j8u E:118-198)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)

8. Domain d2j8ue2: 2j8u E:118-198 [147921]
   Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub1, d2j8ue1, d2j8uf1, d2j8uh1, d2j8uh2, d2j8ui1, d2j8ul1, d2j8um1
   automatically matched to d1lp9e2
   mutant

Details for d2j8ue2

PDB Entry: 2j8u, 2.88 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation.

PDB Compounds: (E:) Beta-2-microglobulin

SCOP Domain Sequences for d2j8ue2:

Sequence; same for both SEQRES and ATOM records:

>d2j8ue2 b.1.1.2 (E:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

Timeline for d2j8ue2:

• d2j8ue2 is new in SCOP 1.75
  
• d2j8ue2 appears in SCOPe 2.01
  
• d2j8ue2 appears in the current release, SCOPe 2.08