Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (369 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d2j8ub_: 2j8u B: [147919] Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ue1, d2j8ue2, d2j8uf1, d2j8uf2, d2j8uh1, d2j8uh2, d2j8ul1, d2j8ul2, d2j8um1, d2j8um2 automated match to d1a9bb_ mutant |
PDB Entry: 2j8u (more details), 2.88 Å
SCOPe Domain Sequences for d2j8ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ub_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2j8ub_: