Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries) Uniprot P01892 25-298 |
Domain d2j8ua2: 2j8u A:1-181 [147918] Other proteins in same PDB: d2j8ua1, d2j8ub2, d2j8ub3, d2j8ue1, d2j8ue2, d2j8uf1, d2j8uf2, d2j8uh1, d2j8ui2, d2j8ui3, d2j8ul1, d2j8ul2, d2j8um1, d2j8um2 automatically matched to d1akja2 mutant |
PDB Entry: 2j8u (more details), 2.88 Å
SCOPe Domain Sequences for d2j8ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetravkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2j8ua2: