SCOPe 2.07: Domain d2j73a_: 2j73 A:

Lineage for d2j73a_ (2j73 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [158937] (3 PDB entries)
   Uniprot O33840 19-102

8. Domain d2j73a_: 2j73 A: [147899]
   automated match to d2j71a1

Details for d2j73a_

PDB Entry: 2j73, 1.4 Å

PDB Description: alpha-glucan rcognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2j73a_:

Sequence; same for both SEQRES and ATOM records:

>d2j73a_ b.3.1.3 (A:) Pullulanase PulA {Thermotoga maritima [TaxId: 2336]}
ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

Timeline for d2j73a_:

• d2j73a_ first appeared in SCOP 1.75, called d2j73a1
  
• d2j73a_ appears in SCOPe 2.06
  
• d2j73a_ appears in the current release, SCOPe 2.08