Lineage for d2j6ja_ (2j6j A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250688Fold e.76: Viral glycoprotein ectodomain-like [161007] (1 superfamily)
    complex fold; contains three rigid, mostly-beta domains and an alpha-helical region, acting as a conformatiomal switch ("fusion stalk")
  4. 2250689Superfamily e.76.1: Viral glycoprotein ectodomain-like [161008] (3 families) (S)
  5. 2250718Family e.76.1.2: Spike glycoprotein-like [161012] (2 proteins)
    Pfam PF00974; Rhabdovirus spike glycoprotein
  6. 2250722Protein automated matches [190430] (2 species)
    not a true protein
  7. 2250728Species Vesicular stomatitis indiana virus [TaxId:11277] [187323] (2 PDB entries)
  8. 2250731Domain d2j6ja_: 2j6j A: [147895]
    automated match to d2cmzb_
    complexed with nag, yb

Details for d2j6ja_

PDB Entry: 2j6j (more details), 3 Å

PDB Description: prefusion form of the vesicular stomatitis virus glycoprotein g ectodomain
PDB Compounds: (A:) Spike glycoprotein

SCOPe Domain Sequences for d2j6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ja_ e.76.1.2 (A:) automated matches {Vesicular stomatitis indiana virus [TaxId: 11277]}
kftivfphnqkgnwknvpsnyhycpsssdlnwhndligtaiqvkmpkshkaiqadgwmch
askwvttcdfrwygpkyitqsirsftpsveqckesieqtkqgtwlnpgfppqscgyatvt
daeavivqvtphhvlvdeytgewvdsqfingkcsnyicptvhnsttwhsdykvkglcdsn
lismditffsedgelsslgkegtgfrsnyfayetggkackmqyckhwgvrlpsgvwfema
dkdlfaaarfpecpegssisapsqtsvdvsliqdverildyslcqetwskiraglpispv
dlsylapknpgtgpaftiingtlkyfetryirvdiaapilsrmvgmisgttterelwddw
apyedveigpngvlrtssgykfplymighgmldsdlhlsskaqvfehphiqda

SCOPe Domain Coordinates for d2j6ja_:

Click to download the PDB-style file with coordinates for d2j6ja_.
(The format of our PDB-style files is described here.)

Timeline for d2j6ja_: