Lineage for d2j62b3 (2j62 B:40-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571780Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2571795Protein Hyaluronidase N-terminal domain [143619] (1 species)
  7. 2571796Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
    Uniprot Q8XL08 41-178
  8. 2571802Domain d2j62b3: 2j62 B:40-178 [147894]
    Other proteins in same PDB: d2j62a1, d2j62a2, d2j62b1, d2j62b2
    automatically matched to 2J62 A:40-178
    complexed with cl, gsz

Details for d2j62b3

PDB Entry: 2j62 (more details), 2.26 Å

PDB Description: structure of a bacterial o-glcnacase in complex with glcnacstatin
PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2j62b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j62b3 d.92.2.3 (B:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

SCOPe Domain Coordinates for d2j62b3:

Click to download the PDB-style file with coordinates for d2j62b3.
(The format of our PDB-style files is described here.)

Timeline for d2j62b3: