Lineage for d2j62b2 (2j62 B:179-495)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440813Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2440848Protein Hyaluronidase catalytic domain [141792] (1 species)
  7. 2440849Species Clostridium perfringens [TaxId:1502] [141793] (8 PDB entries)
    Uniprot Q8XL08 179-495
  8. 2440855Domain d2j62b2: 2j62 B:179-495 [147893]
    Other proteins in same PDB: d2j62a1, d2j62a3, d2j62b1, d2j62b3
    automatically matched to 2J62 A:179-495
    complexed with cl, gsz

Details for d2j62b2

PDB Entry: 2j62 (more details), 2.26 Å

PDB Description: structure of a bacterial o-glcnacase in complex with glcnacstatin
PDB Compounds: (B:) hyaluronidase

SCOPe Domain Sequences for d2j62b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j62b2 c.1.8.10 (B:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d2j62b2:

Click to download the PDB-style file with coordinates for d2j62b2.
(The format of our PDB-style files is described here.)

Timeline for d2j62b2: