Class a: All alpha proteins [46456] (289 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) |
Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species) |
Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries) Uniprot Q8XL08 496-624 |
Domain d2j62b1: 2j62 B:496-624 [147892] Other proteins in same PDB: d2j62a2, d2j62a3, d2j62b2, d2j62b3 automatically matched to 2J62 A:496-624 complexed with cl, gsz |
PDB Entry: 2j62 (more details), 2.26 Å
SCOPe Domain Sequences for d2j62b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j62b1 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]} edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe alsfdltli
Timeline for d2j62b1: