SCOP 1.75: Domain d2j62b1: 2j62 B:496-624

Lineage for d2j62b1 (2j62 B:496-624)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [140660] (3 PDB entries)
   Uniprot Q8XL08 496-624

8. Domain d2j62b1: 2j62 B:496-624 [147892]
   Other proteins in same PDB: d2j62a2, d2j62a3, d2j62b2, d2j62b3
   automatically matched to 2J62 A:496-624
   complexed with cl, gsz

Details for d2j62b1

PDB Entry: 2j62, 2.26 Å

PDB Description: structure of a bacterial o-glcnacase in complex with glcnacstatin

PDB Compounds: (B:) hyaluronidase

SCOP Domain Sequences for d2j62b1:

Sequence; same for both SEQRES and ATOM records:

>d2j62b1 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d2j62b1:

• d2j62b1 is new in SCOP 1.75
  
• d2j62b1 appears in SCOPe 2.01
  
• d2j62b1 appears in the current release, SCOPe 2.08