Lineage for d2j62a2 (2j62 A:179-495)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816744Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 816779Protein Hyaluronidase catalytic domain [141792] (1 species)
  7. 816780Species Clostridium perfringens [TaxId:1502] [141793] (3 PDB entries)
    Uniprot Q8XL08 179-495
  8. 816783Domain d2j62a2: 2j62 A:179-495 [147890]
    Other proteins in same PDB: d2j62a1, d2j62a3, d2j62b1, d2j62b3
    complexed with cl, gsz

Details for d2j62a2

PDB Entry: 2j62 (more details), 2.26 Å

PDB Description: structure of a bacterial o-glcnacase in complex with glcnacstatin
PDB Compounds: (A:) hyaluronidase

SCOP Domain Sequences for d2j62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j62a2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOP Domain Coordinates for d2j62a2:

Click to download the PDB-style file with coordinates for d2j62a2.
(The format of our PDB-style files is described here.)

Timeline for d2j62a2: