Lineage for d2j62a1 (2j62 A:496-624)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351180Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2351181Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 2351196Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)
  7. 2351197Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
    Uniprot Q8XL08 496-624
  8. 2351202Domain d2j62a1: 2j62 A:496-624 [147889]
    Other proteins in same PDB: d2j62a2, d2j62a3, d2j62b2, d2j62b3
    complexed with cl, gsz

Details for d2j62a1

PDB Entry: 2j62 (more details), 2.26 Å

PDB Description: structure of a bacterial o-glcnacase in complex with glcnacstatin
PDB Compounds: (A:) hyaluronidase

SCOPe Domain Sequences for d2j62a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j62a1 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d2j62a1:

Click to download the PDB-style file with coordinates for d2j62a1.
(The format of our PDB-style files is described here.)

Timeline for d2j62a1: