Lineage for d2j5yb1 (2j5y B:1-53)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 764263Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 764284Family a.8.1.2: GA module, an albumin-binding domain [47001] (3 proteins)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 764295Protein PAB [47002] (1 species)
  7. 764296Species Peptostreptococcus magnus [TaxId:1260] [47003] (5 PDB entries)
    Uniprot Q51911 213-265
  8. 764298Domain d2j5yb1: 2j5y B:1-53 [147888]
    automatically matched to d1gaba_

Details for d2j5yb1

PDB Entry: 2j5y (more details), 1.4 Å

PDB Description: crystal structure of the ga module from f.magna
PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOP Domain Sequences for d2j5yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5yb1 a.8.1.2 (B:1-53) PAB {Peptostreptococcus magnus [TaxId: 1260]}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOP Domain Coordinates for d2j5yb1:

Click to download the PDB-style file with coordinates for d2j5yb1.
(The format of our PDB-style files is described here.)

Timeline for d2j5yb1: