SCOPe 2.07: Domain d2j4ga3: 2j4g A:4-126

Lineage for d2j4ga3 (2j4g A:4-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
   Uniprot Q89ZI2 25-147

8. Domain d2j4ga3: 2j4g A:4-126 [147878]
   Other proteins in same PDB: d2j4ga1, d2j4ga2, d2j4gb1, d2j4gb2
   complexed with act, gol, nb1

Details for d2j4ga3

PDB Entry: 2j4g, 2.25 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with n-butyl-thiazoline inhibitor

PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d2j4ga3:

Sequence; same for both SEQRES and ATOM records:

>d2j4ga3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Timeline for d2j4ga3:

• d2j4ga3 first appeared in SCOP 1.75
  
• d2j4ga3 appears in SCOPe 2.06
  
• d2j4ga3 appears in the current release, SCOPe 2.08