Lineage for d2j4ga2 (2j4g A:127-436)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816744Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 816765Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)
  7. 816766Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (7 PDB entries)
    Uniprot Q89ZI2 148-457
  8. 816776Domain d2j4ga2: 2j4g A:127-436 [147877]
    Other proteins in same PDB: d2j4ga1, d2j4ga3, d2j4gb1, d2j4gb3
    complexed with act, gol, nb1

Details for d2j4ga2

PDB Entry: 2j4g (more details), 2.25 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with n-butyl-thiazoline inhibitor
PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOP Domain Sequences for d2j4ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4ga2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOP Domain Coordinates for d2j4ga2:

Click to download the PDB-style file with coordinates for d2j4ga2.
(The format of our PDB-style files is described here.)

Timeline for d2j4ga2: