Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
Protein Glucosaminidase GH84, catalytic domain [141790] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (7 PDB entries) Uniprot Q89ZI2 148-457 |
Domain d2j4ga2: 2j4g A:127-436 [147877] Other proteins in same PDB: d2j4ga1, d2j4ga3, d2j4gb1, d2j4gb3 complexed with act, gol, nb1 |
PDB Entry: 2j4g (more details), 2.25 Å
SCOP Domain Sequences for d2j4ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4ga2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns dlgpnghgyr
Timeline for d2j4ga2: