![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
![]() | Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) ![]() |
![]() | Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
![]() | Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (7 PDB entries) Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611 |
![]() | Domain d2j4ga1: 2j4g A:437-589 [147876] Other proteins in same PDB: d2j4ga2, d2j4ga3, d2j4gb2, d2j4gb3 complexed with act, gol, nb1 |
PDB Entry: 2j4g (more details), 2.25 Å
SCOPe Domain Sequences for d2j4ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4ga1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt atrvikplidrtfatvvkffnqkfnahldattd
Timeline for d2j4ga1: