SCOP 1.75: Domain d2j44a2: 2j44 A:7-109

Lineage for d2j44a2 (2j44 A:7-109)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [158935] (1 PDB entry)
   Uniprot Q97SQ7 135-237! Uniprot Q97SQ7 238-353

8. Domain d2j44a2: 2j44 A:7-109 [147869]
   1st PUD
   complexed with glc, zn

Details for d2j44a2

PDB Entry: 2j44, 2.1 Å

PDB Description: alpha-glucan binding by a streptococcal virulence factor

PDB Compounds: (A:) alkaline amylopullulanase

SCOP Domain Sequences for d2j44a2:

Sequence; same for both SEQRES and ATOM records:

>d2j44a2 b.3.1.3 (A:7-109) Pullulanase PulA {Streptococcus pneumoniae [TaxId: 1313]}
dnyfrihvkklpeenkdaqglwtwddvekpsenwpngalsfkdakkddygyyldvklkge
qakkisflinntagknltgdksveklvpkmneawldqdykvfs

Timeline for d2j44a2:

• d2j44a2 is new in SCOP 1.75
  
• d2j44a2 appears in SCOPe 2.01
  
• d2j44a2 appears in the current release, SCOPe 2.08