Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
Protein Pullulanase PulA [158933] (4 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [158935] (1 PDB entry) Uniprot Q97SQ7 135-237! Uniprot Q97SQ7 238-353 |
Domain d2j44a2: 2j44 A:7-109 [147869] 1st PUD complexed with zn |
PDB Entry: 2j44 (more details), 2.1 Å
SCOPe Domain Sequences for d2j44a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j44a2 b.3.1.3 (A:7-109) Pullulanase PulA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} dnyfrihvkklpeenkdaqglwtwddvekpsenwpngalsfkdakkddygyyldvklkge qakkisflinntagknltgdksveklvpkmneawldqdykvfs
Timeline for d2j44a2: