![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) ![]() |
![]() | Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
![]() | Protein Pullulanase PulA [158933] (4 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [158936] (1 PDB entry) Uniprot Q1JEU6 105-211! Uniprot Q1JEU6 212-323 |
![]() | Domain d2j43a2: 2j43 A:112-223 [147865] 2nd PUD |
PDB Entry: 2j43 (more details), 1.6 Å
SCOP Domain Sequences for d2j43a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j43a2 b.3.1.3 (A:112-223) Pullulanase PulA {Streptococcus pyogenes [TaxId: 1314]} plkegylrinyhnqsghydnlavwtfkdvktpttdwpngldlshkghygayvdvplkega neigflildksktgdaikvqpkdylfkeldnhtqvfvkdtdpkvynnpyyid
Timeline for d2j43a2: