Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Focal adhesion kinase 1 [141432] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [141433] (3 PDB entries) Uniprot Q00944 254-363 |
Domain d2j0ma2: 2j0m A:254-359 [147846] Other proteins in same PDB: d2j0ma1, d2j0ma3, d2j0mb_ automatically matched to d2aeha2 complexed with 4st |
PDB Entry: 2j0m (more details), 2.8 Å
SCOPe Domain Sequences for d2j0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0ma2 b.55.1.5 (A:254-359) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfi
Timeline for d2j0ma2: