SCOPe 2.01: Domain d2j0ma2: 2j0m A:254-359

Lineage for d2j0ma2 (2j0m A:254-359)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Focal adhesion kinase 1 [141432] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [141433] (3 PDB entries)
   Uniprot Q00944 254-363

8. Domain d2j0ma2: 2j0m A:254-359 [147846]
   Other proteins in same PDB: d2j0ma1, d2j0ma3, d2j0mb_
   automatically matched to d2aeha2
   complexed with 4st

Details for d2j0ma2

PDB Entry: 2j0m, 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.

PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0ma2:

Sequence; same for both SEQRES and ATOM records:

>d2j0ma2 b.55.1.5 (A:254-359) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfi

Timeline for d2j0ma2:

• d2j0ma2 first appeared in SCOP 1.75
  
• d2j0ma2 appears in SCOPe 2.02
  
• d2j0ma2 appears in the current release, SCOPe 2.08