SCOPe 2.04: Domain d2j0ma1: 2j0m A:131-253

Lineage for d2j0ma1 (2j0m A:131-253)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [254874] (2 PDB entries)

8. Domain d2j0ma1: 2j0m A:131-253 [147845]
   Other proteins in same PDB: d2j0ma2, d2j0ma3, d2j0mb_
   automated match to d2al6a1
   complexed with 4st

Details for d2j0ma1

PDB Entry: 2j0m, 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.

PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0ma1:

Sequence; same for both SEQRES and ATOM records:

>d2j0ma1 a.11.2.0 (A:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

Timeline for d2j0ma1:

• d2j0ma1 first appeared in SCOP 1.75
  
• d2j0ma1 appears in SCOPe 2.03
  
• d2j0ma1 appears in SCOPe 2.05
  
• d2j0ma1 appears in the current release, SCOPe 2.08