Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Exoribonuclease 2, RNB, N-terminal domain [418920] (1 species) RNase II; protein contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain |
Species Escherichia coli [TaxId:562] [419348] (3 PDB entries) Uniprot P30850 |
Domain d2ix1a3: 2ix1 A:4-82 [147824] Other proteins in same PDB: d2ix1a1, d2ix1a2, d2ix1a4, d2ix1a5 complexed with mg; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ix1 (more details), 2.74 Å
SCOPe Domain Sequences for d2ix1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ix1a3 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB, N-terminal domain {Escherichia coli [TaxId: 562]} adpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiav ihsekeresaepeelvepf
Timeline for d2ix1a3:
View in 3D Domains from same chain: (mouse over for more information) d2ix1a1, d2ix1a2, d2ix1a4, d2ix1a5 |