Lineage for d2ix0a2 (2ix0 A:4-82)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789753Protein Exoribonuclease 2, RNB, N-terminal domain [418920] (1 species)
    RNase II; protein contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain
  7. 2789754Species Escherichia coli [TaxId:562] [419348] (3 PDB entries)
    Uniprot P30850
  8. 2789759Domain d2ix0a2: 2ix0 A:4-82 [147819]
    Other proteins in same PDB: d2ix0a1, d2ix0a3, d2ix0a4
    complexed with c5p, ca, mg
    has additional insertions and/or extensions that are not grouped together

Details for d2ix0a2

PDB Entry: 2ix0 (more details), 2.44 Å

PDB Description: rnase ii
PDB Compounds: (A:) Exoribonuclease 2

SCOPe Domain Sequences for d2ix0a2:

Sequence, based on SEQRES records: (download)

>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB, N-terminal domain {Escherichia coli [TaxId: 562]}
ddpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiav
ihsekeresaepeelvepf

Sequence, based on observed residues (ATOM records): (download)

>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB, N-terminal domain {Escherichia coli [TaxId: 562]}
ddpllaqlkqqlhsqtpraegvvkatefgflevdaqksyfipppqmkkvmhgdriiavih
seresaepeelvepf

SCOPe Domain Coordinates for d2ix0a2:

Click to download the PDB-style file with coordinates for d2ix0a2.
(The format of our PDB-style files is described here.)

Timeline for d2ix0a2: