Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.7: MiaE-like [158405] (1 protein) Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE) |
Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species) |
Species Pseudomonas putida [TaxId:303] [158407] (1 PDB entry) Uniprot Q88KV1 3-201 |
Domain d2itbb1: 2itb B:4-201 [147794] automatically matched to 2ITB A:3-201 complexed with edo, fe, per, unl |
PDB Entry: 2itb (more details), 2.05 Å
SCOP Domain Sequences for d2itbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itbb1 a.25.1.7 (B:4-201) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]} ipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinmms rlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafiea rscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarcvelvraaem eliqspdqelrfhsgipq
Timeline for d2itbb1: