SCOP 1.75: Domain d2itbb1: 2itb B:4-201

Lineage for d2itbb1 (2itb B:4-201)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.7: MiaE-like [158405] (1 protein)
   Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)

6. Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species)

7. Species Pseudomonas putida [TaxId:303] [158407] (1 PDB entry)
   Uniprot Q88KV1 3-201

8. Domain d2itbb1: 2itb B:4-201 [147794]
   automatically matched to 2ITB A:3-201
   complexed with edo, fe, per, unl

Details for d2itbb1

PDB Entry: 2itb, 2.05 Å

PDB Description: crystal structure of a putative trna-(ms(2)io(6)a)-hydroxylase (pp_2188) from pseudomonas putida kt2440 at 2.05 a resolution

PDB Compounds: (B:) TRNA-(Ms(2)io(6)a)-hydroxylase, putative

SCOP Domain Sequences for d2itbb1:

Sequence; same for both SEQRES and ATOM records:

>d2itbb1 a.25.1.7 (B:4-201) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]}
ipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinmms
rlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafiea
rscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarcvelvraaem
eliqspdqelrfhsgipq

Timeline for d2itbb1:

• d2itbb1 is new in SCOP 1.75
  
• d2itbb1 is called d2itbb_ in SCOPe 2.01
  
• d2itbb1 appears in the current release, SCOPe 2.08, called d2itbb_