Lineage for d2it4b_ (2it4 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1328744Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)
  8. 1328767Domain d2it4b_: 2it4 B: [147790]
    automated match to d1azma_
    complexed with ppf, zn

Details for d2it4b_

PDB Entry: 2it4 (more details), 2 Å

PDB Description: x ray structure of the complex between carbonic anhydrase i and the phosphonate antiviral drug foscarnet
PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2it4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2it4b_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOPe Domain Coordinates for d2it4b_:

Click to download the PDB-style file with coordinates for d2it4b_.
(The format of our PDB-style files is described here.)

Timeline for d2it4b_: