SCOP 1.75: Domain d2iq6a1: 2iq6 A:1-291

Lineage for d2iq6a1 (2iq6 A:1-291)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (13 PDB entries)
   Uniprot Q01693
   synonym: Vibrio proteolyticus

8. Domain d2iq6a1: 2iq6 A:1-291 [147771]
   automatically matched to d1ampa_
   complexed with zn

Details for d2iq6a1

PDB Entry: 2iq6, 2 Å

PDB Description: crystal structure of the aminopeptidase from vibrio proteolyticus in complexation with leucyl-leucyl-leucine.

PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOP Domain Sequences for d2iq6a1:

Sequence; same for both SEQRES and ATOM records:

>d2iq6a1 c.56.5.4 (A:1-291) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d2iq6a1:

• d2iq6a1 is new in SCOP 1.75
  
• d2iq6a1 is called d2iq6a_ in SCOPe 2.01
  
• d2iq6a1 appears in the current release, SCOPe 2.08, called d2iq6a_