Lineage for d2ioub2 (2iou B:171-380)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941271Family d.169.1.8: Mtd variable domain [143964] (1 protein)
    fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide
  6. 1941272Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)
  7. 1941273Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries)
    Uniprot Q775D6 171-380
    includes related Bordetella phage proteins
  8. 1941282Domain d2ioub2: 2iou B:171-380 [147753]
    Other proteins in same PDB: d2ioua1, d2ioub1, d2iouc1, d2ioud1, d2ioue1, d2iouf1, d2ioug_, d2iouh_
    automated match to d1yu2a2
    complexed with mg

Details for d2ioub2

PDB Entry: 2iou (more details), 3.16 Å

PDB Description: major tropism determinant p1 (mtd-p1) variant complexed with bordetella brochiseptica virulence factor pertactin extracellular domain (prn-e).
PDB Compounds: (B:) Major Tropism Determinant P1

SCOPe Domain Sequences for d2ioub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioub2 d.169.1.8 (B:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggawngtsl
sgsraalwysgpsfsfaffgargvcdhlil

SCOPe Domain Coordinates for d2ioub2:

Click to download the PDB-style file with coordinates for d2ioub2.
(The format of our PDB-style files is described here.)

Timeline for d2ioub2: