Lineage for d2iokb1 (2iok B:1306-1544)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776557Protein Estrogen receptor alpha [48519] (1 species)
  7. 776558Species Human (Homo sapiens) [TaxId:9606] [48520] (29 PDB entries)
    Uniprot P03372 307-551
  8. 776609Domain d2iokb1: 2iok B:1306-1544 [147748]
    automatically matched to d1qkua_
    complexed with iok

Details for d2iokb1

PDB Entry: 2iok (more details), 2.4 Å

PDB Description: Human estrogen receptor alpha ligand-binding domain in complex with compound 1D
PDB Compounds: (B:) Estrogen receptor

SCOP Domain Sequences for d2iokb1:

Sequence, based on SEQRES records: (download)

>d2iokb1 a.123.1.1 (B:1306-1544) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml

Sequence, based on observed residues (ATOM records): (download)

>d2iokb1 a.123.1.1 (B:1306-1544) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrasmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
makagltlqqqhqrlaqlllilshirhmsnkgmehlysplydllleml

SCOP Domain Coordinates for d2iokb1:

Click to download the PDB-style file with coordinates for d2iokb1.
(The format of our PDB-style files is described here.)

Timeline for d2iokb1: