Lineage for d2ioga1 (2iog A:309-550)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776557Protein Estrogen receptor alpha [48519] (1 species)
  7. 776558Species Human (Homo sapiens) [TaxId:9606] [48520] (29 PDB entries)
    Uniprot P03372 307-551
  8. 776563Domain d2ioga1: 2iog A:309-550 [147744]
    automatically matched to d1qkua_
    complexed with iog

Details for d2ioga1

PDB Entry: 2iog (more details), 1.6 Å

PDB Description: Human estrogen receptor alpha ligand-binding domain in complex with compound 11F
PDB Compounds: (A:) Estrogen receptor

SCOP Domain Sequences for d2ioga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioga1 a.123.1.1 (A:309-550) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
lh

SCOP Domain Coordinates for d2ioga1:

Click to download the PDB-style file with coordinates for d2ioga1.
(The format of our PDB-style files is described here.)

Timeline for d2ioga1: