SCOPe 2.06: Domain d2iocb_: 2ioc B:

Lineage for d2iocb_ (2ioc B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d2iocb_: 2ioc B: [147743]
   Other proteins in same PDB: d2ioca1
   automated match to d1y97a1
   complexed with d5m, mn

Details for d2iocb_

PDB Entry: 2ioc, 2.1 Å

PDB Description: the crystal structure of trex1 explains the 3' nucleotide specificity and reveals a polyproline ii helix for protein partenring

PDB Compounds: (B:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d2iocb_:

Sequence, based on SEQRES records:

>d2iocb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrly
wqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d2iocb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasrksyslgsiytrlywqaptds
htaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d2iocb_:

• d2iocb_ first appeared in SCOP 1.75, called d2iocb1
  
• d2iocb_ appears in SCOPe 2.05
  
• d2iocb_ appears in SCOPe 2.07
  
• d2iocb_ appears in the current release, SCOPe 2.08