Lineage for d2iocb_ (2ioc B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860371Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)
  8. 1860376Domain d2iocb_: 2ioc B: [147743]
    Other proteins in same PDB: d2ioca1
    automated match to d1y97a1
    complexed with d5m, mn

Details for d2iocb_

PDB Entry: 2ioc (more details), 2.1 Å

PDB Description: the crystal structure of trex1 explains the 3' nucleotide specificity and reveals a polyproline ii helix for protein partenring
PDB Compounds: (B:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d2iocb_:

Sequence, based on SEQRES records: (download)

>d2iocb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrly
wqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d2iocb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasrksyslgsiytrlywqaptds
htaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOPe Domain Coordinates for d2iocb_:

Click to download the PDB-style file with coordinates for d2iocb_.
(The format of our PDB-style files is described here.)

Timeline for d2iocb_: