Lineage for d2il5a1 (2il5 A:5-168)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218469Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
    Pfam PF05146
  6. 1218504Protein Hypothetical protein SA2116 [160736] (1 species)
  7. 1218505Species Staphylococcus aureus [TaxId:1280] [160737] (1 PDB entry)
    Uniprot Q2FEH1 5-168
  8. 1218506Domain d2il5a1: 2il5 A:5-168 [147723]
    complexed with na

Details for d2il5a1

PDB Entry: 2il5 (more details), 2.3 Å

PDB Description: Structure of Protein of Unknown Function SA2116 from Staphylococcus aureus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2il5a1:

Sequence, based on SEQRES records: (download)

>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]}
nvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeggkyrivd
qqrngkvnviegiyeslvmdeyvkmtigmpglsetqdvievefferetggtqmlfyyrsl
vekerrftnleykqkkkeyhdamvhgfelmfdkmyhvietstqq

Sequence, based on observed residues (ATOM records): (download)

>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]}
nvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeggkyrivd
qqrngkvnviegiyeslvmdeyvkmtigmpsetqdvievefferetggtqmlfyyrslve
kerrftnleykqkkkeyhdamvhgfelmfdkmyhvietstqq

SCOPe Domain Coordinates for d2il5a1:

Click to download the PDB-style file with coordinates for d2il5a1.
(The format of our PDB-style files is described here.)

Timeline for d2il5a1: