Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein T4 RNase H [53046] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries) |
Domain d2ihna2: 2ihn A:12-180 [147680] Other proteins in same PDB: d2ihna1 automatically matched to d1tfra2 protein/DNA complex |
PDB Entry: 2ihn (more details), 3 Å
SCOPe Domain Sequences for d2ihna2:
Sequence, based on SEQRES records: (download)
>d2ihna2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid naksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkyea ndhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
>d2ihna2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid naksgywrrdfayyykknrstwdwegyfesshkvidelkaympyivmdidkyeandhiav lvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
Timeline for d2ihna2: