Lineage for d2ih2a1 (2ih2 A:21-243)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893784Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (2 proteins)
  6. 2893785Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 2893786Species Thermus aquaticus [TaxId:271] [53370] (11 PDB entries)
  8. 2893787Domain d2ih2a1: 2ih2 A:21-243 [147669]
    Other proteins in same PDB: d2ih2a2, d2ih2d2
    automatically matched to d1aqia1
    protein/DNA complex; complexed with gol, nea

Details for d2ih2a1

PDB Entry: 2ih2 (more details), 1.61 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 5- methylpyrimidin-2(1h)-one at the target base partner position
PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d2ih2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

SCOPe Domain Coordinates for d2ih2a1:

Click to download the PDB-style file with coordinates for d2ih2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ih2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ih2a2