Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Exoribonuclease 2, RNB [159089] (1 species) RNase II; contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain |
Species Escherichia coli [TaxId:562] [159090] (3 PDB entries) Uniprot P30850 1-82! Uniprot P30850 4-82! Uniprot P30850 5-82! Uniprot P30850 558-643! Uniprot P30850 558-644! Uniprot P30850 83-172 |
Domain d2id0a2: 2id0 A:83-172 [147607] Other proteins in same PDB: d2id0a4, d2id0b4, d2id0c4, d2id0d4 complexed with mn |
PDB Entry: 2id0 (more details), 2.35 Å
SCOPe Domain Sequences for d2id0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id0a2 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} ltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefkegdwavaemrrhplkgdrs fyaeltqyitfgddhfvpwwvtlarhnlek
Timeline for d2id0a2: