Lineage for d2icta1 (2ict A:8-94)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768088Family a.35.1.3: SinR domain-like [47432] (8 proteins)
  6. 768089Protein Antitoxin HigA [158465] (1 species)
    Uncharacterized transcriptional regulator YddM
  7. 768090Species Escherichia coli [TaxId:562] [158466] (2 PDB entries)
    Uniprot P67699 8-94
  8. 768091Domain d2icta1: 2ict A:8-94 [147605]
    automatically matched to 2ICP A:8-94

Details for d2icta1

PDB Entry: 2ict (more details), 1.63 Å

PDB Description: crystal structure of the bacterial antitoxin higa from escherichia coli at ph 8.5. northeast structural genomics target er390.
PDB Compounds: (A:) antitoxin higa

SCOP Domain Sequences for d2icta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]}
rpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvigsspqmw
lnlqnawslaeaektvdvsrlrrlvtq

SCOP Domain Coordinates for d2icta1:

Click to download the PDB-style file with coordinates for d2icta1.
(The format of our PDB-style files is described here.)

Timeline for d2icta1: