Lineage for d2iazd_ (2iaz D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 929100Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 929101Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 929107Family a.281.1.2: YheA-like [158626] (4 proteins)
    Pfam PF06133; DUF964
  6. 929108Protein Hypothetical protein SP1372 [158629] (1 species)
  7. 929109Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [158630] (1 PDB entry)
    Uniprot Q97Q59 1-111
  8. 929113Domain d2iazd_: 2iaz D: [147596]
    automated match to d2iaza1

Details for d2iazd_

PDB Entry: 2iaz (more details), 2.4 Å

PDB Description: Crystal structure of a Conserved Protein of Unknown Function SP1372 from Streptococcus pneumoniae
PDB Compounds: (D:) Hypothetical protein SP1372

SCOPe Domain Sequences for d2iazd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iazd_ a.281.1.2 (D:) Hypothetical protein SP1372 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gmsniydsanelsrglrglpeykavkaakdaiaadaeaskiftdylafqeeiqklaqtgq
mpdasfqakmegfgkqiqgnsllsefftkqqqlaiylsdiekivfepvsellk

SCOPe Domain Coordinates for d2iazd_:

Click to download the PDB-style file with coordinates for d2iazd_.
(The format of our PDB-style files is described here.)

Timeline for d2iazd_: