Lineage for d2iazb1 (2iaz B:1-111)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781352Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 781353Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 781359Family a.281.1.2: YheA-like [158626] (3 proteins)
    Pfam PF06133; DUF964
  6. 781360Protein Hypothetical protein SP1372 [158629] (1 species)
  7. 781361Species Streptococcus pneumoniae [TaxId:1313] [158630] (1 PDB entry)
    Uniprot Q97Q59 1-111
  8. 781363Domain d2iazb1: 2iaz B:1-111 [147594]
    automatically matched to 2IAZ A:1-111

Details for d2iazb1

PDB Entry: 2iaz (more details), 2.4 Å

PDB Description: Crystal structure of a Conserved Protein of Unknown Function SP1372 from Streptococcus pneumoniae
PDB Compounds: (B:) Hypothetical protein SP1372

SCOP Domain Sequences for d2iazb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iazb1 a.281.1.2 (B:1-111) Hypothetical protein SP1372 {Streptococcus pneumoniae [TaxId: 1313]}
msniydsanelsrglrglpeykavkaakdaiaadaeaskiftdylafqeeiqklaqtgqm
pdasfqakmegfgkqiqgnsllsefftkqqqlaiylsdiekivfepvsell

SCOP Domain Coordinates for d2iazb1:

Click to download the PDB-style file with coordinates for d2iazb1.
(The format of our PDB-style files is described here.)

Timeline for d2iazb1: