Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (3 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Pantothenate kinase 1, PANK1 [159628] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159629] (1 PDB entry) Uniprot Q8TE04 236-381! Uniprot Q8TE04 382-593 |
Domain d2i7na2: 2i7n A:382-593 [147548] complexed with aco |
PDB Entry: 2i7n (more details), 1.9 Å
SCOP Domain Sequences for d2i7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} kpecyyfenptnpelcqkkpycldnpypmllvnmgsgvsilavyskdnykrvtgtslggg tflglcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmm skekrdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllay amdfwskgqlkalflehegyfgavgallelfk
Timeline for d2i7na2: