SCOP 1.75: Domain d2i7na2: 2i7n A:382-593

Lineage for d2i7na2 (2i7n A:382-593)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (3 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein Pantothenate kinase 1, PANK1 [159628] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159629] (1 PDB entry)
   Uniprot Q8TE04 236-381! Uniprot Q8TE04 382-593

8. Domain d2i7na2: 2i7n A:382-593 [147548]
   complexed with aco

Details for d2i7na2

PDB Entry: 2i7n, 1.9 Å

PDB Description: Crystal structure of human PANK1 alpha: the catalytic core domain in complex with AcCoA

PDB Compounds: (A:) Pantothenate kinase 1

SCOP Domain Sequences for d2i7na2:

Sequence; same for both SEQRES and ATOM records:

>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]}
kpecyyfenptnpelcqkkpycldnpypmllvnmgsgvsilavyskdnykrvtgtslggg
tflglcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmm
skekrdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllay
amdfwskgqlkalflehegyfgavgallelfk

Timeline for d2i7na2:

• d2i7na2 is new in SCOP 1.75
  
• d2i7na2 appears in SCOPe 2.01
  
• d2i7na2 appears in the current release, SCOPe 2.08