SCOPe 2.05: Domain d2i5fa_: 2i5f A:

Lineage for d2i5fa_ (2i5f A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Pleckstrin [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)

8. Domain d2i5fa_: 2i5f A: [147512]
   automated match to d1x05a1
   complexed with 5ip

Details for d2i5fa_

PDB Entry: 2i5f, 1.35 Å

PDB Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,5,6)P5

PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d2i5fa_:

Sequence, based on SEQRES records:

>d2i5fa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
ftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsv
esnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records):

>d2i5fa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
ftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsv
eseenlfeiitadevhyflqaatpkertewikaiqmasr

Timeline for d2i5fa_:

• d2i5fa_ first appeared in SCOP 1.75, called d2i5fa1
  
• d2i5fa_ appears in SCOPe 2.04
  
• d2i5fa_ is called d2i5fa2 in SCOPe 2.06
  
• d2i5fa_ appears in the current release, SCOPe 2.08, called d2i5fa2