Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.5: EpsC C-terminal domain-like [159046] (1 protein) PfamB PB005596 |
Protein General secretion pathway protein C, EpsC [159047] (1 species) |
Species Vibrio cholerae [TaxId:666] [159048] (2 PDB entries) Uniprot P45777 204-305! Uniprot P45777 219-305 |
Domain d2i4sb_: 2i4s B: [147504] automated match to d2i4sa1 |
PDB Entry: 2i4s (more details), 1.92 Å
SCOPe Domain Sequences for d2i4sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i4sb_ b.36.1.5 (B:) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} gamedkvdaireaiarnpqeifqyvrlsqvkrddkvlgyrvspgkdpvlfesiglqdgdm avalngldltdpnvmntlfqsmnemtemsltverdgqqhdvyiqf
Timeline for d2i4sb_: