Lineage for d2i4sb_ (2i4s B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538952Family b.36.1.5: EpsC C-terminal domain-like [159046] (1 protein)
    PfamB PB005596
  6. 1538953Protein General secretion pathway protein C, EpsC [159047] (1 species)
  7. 1538954Species Vibrio cholerae [TaxId:666] [159048] (2 PDB entries)
    Uniprot P45777 204-305! Uniprot P45777 219-305
  8. 1538957Domain d2i4sb_: 2i4s B: [147504]
    automated match to d2i4sa1

Details for d2i4sb_

PDB Entry: 2i4s (more details), 1.92 Å

PDB Description: pdz domain of epsc from vibrio cholerae, residues 204-305
PDB Compounds: (B:) General secretion pathway protein C

SCOPe Domain Sequences for d2i4sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i4sb_ b.36.1.5 (B:) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]}
gamedkvdaireaiarnpqeifqyvrlsqvkrddkvlgyrvspgkdpvlfesiglqdgdm
avalngldltdpnvmntlfqsmnemtemsltverdgqqhdvyiqf

SCOPe Domain Coordinates for d2i4sb_:

Click to download the PDB-style file with coordinates for d2i4sb_.
(The format of our PDB-style files is described here.)

Timeline for d2i4sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i4sa1