Class a: All alpha proteins [46456] (284 folds) |
Fold a.136: FinO-like [48656] (1 superfamily) 6 helices: irregular non-globular array; also contains two small beta-hairpins |
Superfamily a.136.1: FinO-like [48657] (1 family) |
Family a.136.1.1: FinO-like [48658] (2 proteins) |
Protein Hypothetical protein NMB1681 [158846] (1 species) |
Species Neisseria meningitidis [TaxId:487] [158847] (1 PDB entry) Uniprot Q9JY98 3-118 |
Domain d2hxjf1: 2hxj F:3-115 [147436] automatically matched to 2HXJ A:3-118 complexed with edo |
PDB Entry: 2hxj (more details), 2.21 Å
SCOP Domain Sequences for d2hxjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxjf1 a.136.1.1 (F:3-115) Hypothetical protein NMB1681 {Neisseria meningitidis [TaxId: 487]} qetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaa liarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqa
Timeline for d2hxjf1:
View in 3D Domains from other chains: (mouse over for more information) d2hxja1, d2hxjc1, d2hxjd1, d2hxje1 |