Lineage for d2hxjf1 (2hxj F:3-115)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778324Fold a.136: FinO-like [48656] (1 superfamily)
    6 helices: irregular non-globular array; also contains two small beta-hairpins
  4. 778325Superfamily a.136.1: FinO-like [48657] (1 family) (S)
  5. 778326Family a.136.1.1: FinO-like [48658] (2 proteins)
  6. 778327Protein Hypothetical protein NMB1681 [158846] (1 species)
  7. 778328Species Neisseria meningitidis [TaxId:487] [158847] (1 PDB entry)
    Uniprot Q9JY98 3-118
  8. 778333Domain d2hxjf1: 2hxj F:3-115 [147436]
    automatically matched to 2HXJ A:3-118
    complexed with edo

Details for d2hxjf1

PDB Entry: 2hxj (more details), 2.21 Å

PDB Description: Crystal structure of a Protein of Unknown Function NMB1681 from Neisseria Meningitidis MC58, Possible Nucleic Acid Binding Protein
PDB Compounds: (F:) hypothetical protein

SCOP Domain Sequences for d2hxjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxjf1 a.136.1.1 (F:3-115) Hypothetical protein NMB1681 {Neisseria meningitidis [TaxId: 487]}
qetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaa
liarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqa

SCOP Domain Coordinates for d2hxjf1:

Click to download the PDB-style file with coordinates for d2hxjf1.
(The format of our PDB-style files is described here.)

Timeline for d2hxjf1:

  • d2hxjf1 is new in SCOP 1.75
  • d2hxjf1 does not appear in SCOPe 2.01