Lineage for d2hvca_ (2hvc A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923260Protein Androgen receptor [63621] (4 species)
  7. 923270Species Human (Homo sapiens) [TaxId:9606] [63623] (46 PDB entries)
    Uniprot P10275 671-919
  8. 923303Domain d2hvca_: 2hvc A: [147418]
    automated match to d1e3ga_
    protein/DNA complex; complexed with lgd

Details for d2hvca_

PDB Entry: 2hvc (more details), 2.1 Å

PDB Description: The Crystal Structure of Ligand-binding Domain (LBD) of human Androgen Receptor in Complex with a selective modulator LGD2226
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2hvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvca_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOPe Domain Coordinates for d2hvca_:

Click to download the PDB-style file with coordinates for d2hvca_.
(The format of our PDB-style files is described here.)

Timeline for d2hvca_: