SCOP 1.75: Domain d2hqua1: 2hqu A:24-159

Lineage for d2hqua1 (2hqu A:24-159)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)

8. Domain d2hqua1: 2hqu A:24-159 [147361]
   automatically matched to d1q5hc_
   complexed with cl, dup, mg

Details for d2hqua1

PDB Entry: 2hqu, 2.2 Å

PDB Description: human dutpase in complex with alpha,beta-iminodutp and magnesium ion

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d2hqua1:

Sequence, based on SEQRES records:

>d2hqua1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfg

Sequence, based on observed residues (ATOM records):

>d2hqua1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrraagydlysaydytippmekavvktdiqialpsgcygrvaprs
glaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeieevq
alddtergsggfg

Timeline for d2hqua1:

• d2hqua1 is new in SCOP 1.75
  
• d2hqua1 appears in SCOPe 2.01
  
• d2hqua1 appears in the current release, SCOPe 2.08, called d2hqua_