Lineage for d2hqtc_ (2hqt C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 916160Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
    PfamB PB021108
  6. 916161Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)
  7. 916162Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
    Uniprot P46672 4-121
  8. 916165Domain d2hqtc_: 2hqt C: [147343]
    automated match to d2hqta1
    complexed with so4

Details for d2hqtc_

PDB Entry: 2hqt (more details), 1.9 Å

PDB Description: crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold
PDB Compounds: (C:) GU4 nucleic-binding protein 1

SCOPe Domain Sequences for d2hqtc_:

Sequence, based on SEQRES records: (download)

>d2hqtc_ a.45.1.2 (C:) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstly
ptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei

Sequence, based on observed residues (ATOM records): (download)

>d2hqtc_ a.45.1.2 (C:) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dlvtkfesliisksftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstlypts
tdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei

SCOPe Domain Coordinates for d2hqtc_:

Click to download the PDB-style file with coordinates for d2hqtc_.
(The format of our PDB-style files is described here.)

Timeline for d2hqtc_: